PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof004279
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 216aa    MW: 24815.6 Da    PI: 4.3848
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-27467PU_refplantGDBView CDS
gnl|UG|Sof#S17398911PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.57.1e-0965107145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+W++ + +l++++ +q+G++ ++ I + ++  +t+ q++ ++ 
        Sof004279  65 RGKWSKSDTDLFYEGLRQFGSD-FAMIQQLFP-DKTRHQVRQKFK 107
                      89********************.*********.********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.1E-2558138No hitNo description
SuperFamilySSF466898.97E-1159113IPR009057Homeodomain-like
PROSITE profilePS5129310.2663114IPR017884SANT domain
SMARTSM007172.0E-864112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-565108IPR009057Homeodomain-like
CDDcd001671.08E-567107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
XRARVNPKEA PSGPSSNTRS FELGDMDDLD YRDEEARFFD NDGTENHVQN ATKLNYQSYM  60
NKPARGKWSK SDTDLFYEGL RQFGSDFAMI QQLFPDKTRH QVRQKFKSEE KKNPLLVHDA  120
IIHRSGDNLY FKKVIKQLNI EDVVLPEINN TQKQDGASSE RGPGNENVLD DFNEEENSSN  180
WSNEEHGGQM ADVQEEHDLG KGGDDDDDLG DVFDWY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.237610.0callus| crown| root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444943.11e-133hypothetical protein SORBIDRAFT_07g001792, partial
TrEMBLC5YME61e-133C5YME6_SORBI; Putative uncharacterized protein Sb07g001792 (Fragment)
STRINGSb07g001792.11e-133(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.18e-31MYB_related family protein